PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11884_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 144aa    MW: 16830.8 Da    PI: 9.5125
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11884_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.4e-08931262154
                                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           k +yp++e++++L +++gL+ +q+ +WF N+R +
  cra_locus_11884_iso_2_len_1198_ver_3  93 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 126
                                           469*****************************87 PP

2ELK28.82.9e-104768122
                                   ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                                          ELK++L+++Y+++++++++E++
  cra_locus_11884_iso_2_len_1198_ver_3 47 ELKRELKQGYKEKIVDIREEIL 68
                                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037899.7E-74768IPR005539ELK domain
SMARTSM011880.00174768IPR005539ELK domain
PROSITE profilePS512139.9174767IPR005539ELK domain
PROSITE profilePS5007111.72667130IPR001356Homeobox domain
SuperFamilySSF466894.28E-1769133IPR009057Homeodomain-like
SMARTSM003892.4E-1169134IPR001356Homeobox domain
CDDcd000864.19E-1070131No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2674131IPR009057Homeodomain-like
PfamPF059202.2E-1887126IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MSDDDDDQVD SDANLFDGSL DDPDSMGFGP LIPTESERSL MERVRQELKR ELKQGYKEKI  60
VDIREEILRK RRAGKLPGDT TSVLKAWWQS HSKWPYPTEE DKARLVQETG LQLKQINNWF  120
INQRKRNWHS NPSSSTASKS KRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-1470134872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123143RKRNWHSNPSSSTASKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522507.13e-94PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480006e-90KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0B2QQU14e-95A0A0B2QQU1_GLYSO; Homeobox protein knotted-1-like 3
TrEMBLA0A0B2R7P72e-96A0A0B2R7P7_GLYSO; Homeobox protein knotted-1-like 3
TrEMBLA0A0V0ID048e-95A0A0V0ID04_SOLCH; Putative homeobox protein knotted-1-like 3-like
TrEMBLF5A6B52e-94F5A6B5_FRAVE; Knotted-like homeobox KNOX5
TrEMBLI1JU994e-94I1JU99_SOYBN; Uncharacterized protein
TrEMBLV7ATS54e-94V7ATS5_PHAVU; Uncharacterized protein
STRINGPOPTR_0006s27560.14e-94(Populus trichocarpa)
STRINGGLYMA04G06810.11e-93(Glycine max)